PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_5374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 346aa    MW: 38947.1 Da    PI: 7.2411
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_5374.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64.3e-52171451129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lp+GfrFhPtd e++++yL +kv +k++++  vi+evd++k+ePwdLp++v+ ++   yfFs++d ky+tg r+nrat++gyWkatgkdke+++  ++
  MLOC_5374.1  17 LPQGFRFHPTDMEIITFYLVPKVLKKPFDT-MVIEEVDLNKCEPWDLPNQVNMGDMAQYFFSRKDLKYPTGVRTNRATNAGYWKATGKDKEIFHPpTR 113
                  799************************999.89***************99999999**************************************9888 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                  +l+g+kktLvfykgrap+gekt+W+mheyrle
  MLOC_5374.1 114 SLIGMKKTLVFYKGRAPRGEKTNWIMHEYRLE 145
                  89****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-587180IPR003441NAC domain
PROSITE profilePS5100554.79517180IPR003441NAC domain
PfamPF023653.1E-2618144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAVHLQAQEQ QQHHLNLPQG FRFHPTDMEI ITFYLVPKVL KKPFDTMVIE EVDLNKCEPW  60
DLPNQVNMGD MAQYFFSRKD LKYPTGVRTN RATNAGYWKA TGKDKEIFHP PTRSLIGMKK  120
TLVFYKGRAP RGEKTNWIMH EYRLETGKKP TPGLPTDIAR ATTINASSKE EYVVCRIFHK  180
STGLKKVRMP SYVMSMGAEQ QHDFFESNTF APLMNYSTSS SSPLPPLSEG SLYQMHNIGV  240
GSSMMGSDVL PMMNNHYFEN HHHQMLVAPP QSSISFYNNN QQQQMMHISA DQGFIVGVDA  300
GSGTSSIVSQ EDVVTGVNNN IQGNGGATTS SEISSVNMGM DDMWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-4541863171NAC domain-containing protein 19
4dul_A7e-4541863171NAC domain-containing protein 19
1ut7_B7e-4541863171NO APICAL MERISTEM PROTEIN
1ut7_A7e-4541863171NO APICAL MERISTEM PROTEIN
1ut4_B7e-4541863171NO APICAL MERISTEM PROTEIN
1ut4_A7e-4541863171NO APICAL MERISTEM PROTEIN
3ulx_A8e-4551863174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565350.11e-80PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLJ27e-68NC100_ARATH; NAC domain-containing protein 100
SwissprotQ9FLR35e-68NAC79_ARATH; NAC domain-containing protein 79
TrEMBLG2ZH110.0G2ZH11_HORVD; NAC transcription factor
STRINGMLOC_5374.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.13e-68NAC domain containing protein 58